PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G06490.1
Common NameAtMYB108, BOS1, F5E6.18, MYB108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 323aa    MW: 37019.7 Da    PI: 4.6626
Description myb domain protein 108
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G06490.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-172168148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l ++++  G g+W++ +r+ g+ Rt+k+c++rw++yl
      AT3G06490.1 21 RGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 68
                     89********************************************97 PP

2Myb_DNA-binding50.54.8e-1674117146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      AT3G06490.1  74 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 117
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7421668IPR017930Myb domain
SuperFamilySSF466891.2E-3018115IPR009057Homeodomain-like
SMARTSM007177.1E-132070IPR001005SANT/Myb domain
PfamPF002495.5E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-222275IPR009057Homeodomain-like
CDDcd001677.99E-102368No hitNo description
PROSITE profilePS5129422.91769123IPR017930Myb domain
SMARTSM007172.9E-1473121IPR001005SANT/Myb domain
PfamPF002498.0E-1574117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2276122IPR009057Homeodomain-like
CDDcd001679.89E-794117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0006952Biological Processdefense response
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDEKGRSLKN NNMEDEMDLK RGPWTAEEDF KLMNYIATNG EGRWNSLSRC AGLQRTGKSC  60
RLRWLNYLRP DVRRGNITLE EQLLILELHS RWGNRWSKIA QYLPGRTDNE IKNYWRTRVQ  120
KHAKQLKCDV NSQQFKDTMK YLWMPRLVER IQSASASSAA AATTTTTTTT GSAGTSSCIT  180
TSNNQFMNYD YNNNNMGQQF GVMSNNDYIT PENSSVAVSP ASDLTEYYSA PNPNPEYYSG  240
QMGNSYYPDQ NLVSSQLLPD NYFDYSGLLD EDLTAMQEQS NLSWFENING AASSSDSLWN  300
IGETDEEFWF LQQQQQFNNN GSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-251811524120MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3341851360.0
Genevisible258516_at0.0
Expression AtlasAT3G06490-
AtGenExpressAT3G06490-
ATTED-IIAT3G06490-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed specifically in flowers. Restricted to anthers in maturing flowers. Strongest expression in the vascular and connective tissue where the anther attaches to the filament. Not detected in pollen. {ECO:0000269|PubMed:19091873}.
Functional Description ? help Back to Top
Source Description
TAIRputative transcription factor MYB108 (MYB108) mRNA,
UniProtTranscription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}.
Function -- GeneRIF ? help Back to Top
  1. Complexes containing R2R3 MYB and bHLH transcription factors regulate the expression of TTG2, which then regulates GL2 expression with complexes containing R2R3 MYB.
    [PMID: 17766401]
  2. MYB108 and MYB24 have overlapping functions and act downstream of MYB21 in a transcriptional cascade that mediates stamen and pollen maturation in response to jasmonate in Arabidopsis.
    [PMID: 19091873]
  3. a new role in cell cycle regulation
    [PMID: 19881525]
  4. after D. dadantii infection, the expression of the Arabidopsis BOS1 gene was specifically induced by the production of the bacterial PelB/C pectinases able to degrade pectin
    [PMID: 21533045]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G06490.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT3G27810 (A), AT5G40350 (A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene, jasmonic acid, Jasmonic acid
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Reduced male fertility associated with delayed anther dehiscence, reduced pollen viability and decreased fecundity. Increased susceptibility to Botrytis infection. Myb24 and myb108 double mutant has a reduced fertility and a greatly reduced seed set relative to the myb108 parental allele. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G06490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2627330.0AF262733.2 Arabidopsis thaliana putative transcription factor MYB108 (MYB108) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_187301.10.0putative transcription factor MYB108
SwissprotQ9LDE10.0MY108_ARATH; Transcription factor MYB108
TrEMBLD7L5I60.0D7L5I6_ARALL; Botrytis-susceptible1, myb domain protein 108
STRINGAT3G06490.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Mengiste T,Chen X,Salmeron J,Dietrich R
    The BOTRYTIS SUSCEPTIBLE1 gene encodes an R2R3MYB transcription factor protein that is required for biotic and abiotic stress responses in Arabidopsis.
    Plant Cell, 2003. 15(11): p. 2551-65
    [PMID:14555693]
  4. Veronese P, et al.
    The BOS loci of Arabidopsis are required for resistance to Botrytis cinerea infection.
    Plant J., 2004. 40(4): p. 558-74
    [PMID:15500471]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Truman W,de Zabala MT,Grant M
    Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
    Plant J., 2006. 46(1): p. 14-33
    [PMID:16553893]
  7. Thilmony R,Underwood W,He SY
    Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7.
    Plant J., 2006. 46(1): p. 34-53
    [PMID:16553894]
  8. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  9. Ishida T, et al.
    Arabidopsis TRANSPARENT TESTA GLABRA2 is directly regulated by R2R3 MYB transcription factors and is involved in regulation of GLABRA2 transcription in epidermal differentiation.
    Plant Cell, 2007. 19(8): p. 2531-43
    [PMID:17766401]
  10. Mandaokar A,Browse J
    MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.
    Plant Physiol., 2009. 149(2): p. 851-62
    [PMID:19091873]
  11. Cominelli E,Tonelli C
    A new role for plant R2R3-MYB transcription factors in cell cycle regulation.
    Cell Res., 2009. 19(11): p. 1231-2
    [PMID:19881525]
  12. Luo H, et al.
    The Arabidopsis Botrytis Susceptible1 Interactor defines a subclass of RING E3 ligases that regulate pathogen and stress responses.
    Plant Physiol., 2010. 154(4): p. 1766-82
    [PMID:20921156]
  13. Kraepiel Y, et al.
    Analysis of the plant bos1 mutant highlights necrosis as an efficient defence mechanism during D. dadantii/Arabidospis thaliana interaction.
    PLoS ONE, 2011. 6(4): p. e18991
    [PMID:21533045]
  14. Cui F,Brosch
    Regulation of ABA dependent wound induced spreading cell death by MYB108.
    New Phytol., 2013. 200(3): p. 634-40
    [PMID:23952703]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]